PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10017656
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family bZIP
Protein Properties Length: 301aa    MW: 33628.7 Da    PI: 6.2893
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10017656genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_133.87.5e-11172215548
                  CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
       bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkke 48 
                  kr +r   NR +A+rsR RK+++i eLe+ v +L+ae + L  +
  Lus10017656 172 KRVKRILANRQSAQRSRVRKLQYISELERSVTSLQAEVSVLSPR 215
                  8999********************************98877655 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003381.5E-13168232IPR004827Basic-leucine zipper domain
PROSITE profilePS502179.622170222IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1704.5E-13172223No hitNo description
PfamPF001702.8E-9172216IPR004827Basic-leucine zipper domain
SuperFamilySSF579592.73E-11172226No hitNo description
CDDcd147031.12E-23173223No hitNo description
PROSITE patternPS000360175190IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009555Biological Processpollen development
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 301 aa     Download sequence    Send to blast
MAQLPPKIPT LPSSWPDFSS DQKPHSAAAQ PPSSAAAANN NHPSWVDEFL DFSSARRGTH  60
RRSASDSIAF LETPLMTLDD DCRGRSNTNG SNNNHIQRHG QHDFDKFDDE QFMSMFSVDD  120
MSSNPGGSNS DDHDSINDDK EAATTTGQSE DNSQQTTPSN GDNNGDRIFD PKRVKRILAN  180
RQSAQRSRVR KLQYISELER SVTSLQAEVS VLSPRVAFLD HQRLLLNVDN SAIKQRIAAL  240
AQDKIFKDAH QEALKREIER LRQVYQHQNN KKADHATAQN NEPTPMTSTV DQKEQQLLQV  300
*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012079033.11e-119PREDICTED: basic leucine zipper 61-like
SwissprotF4IN231e-103BZP34_ARATH; Basic leucine zipper 34
TrEMBLA0A067K9X81e-119A0A067K9X8_JATCU; Uncharacterized protein
STRINGVIT_12s0028g02590.t011e-102(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF20113488
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G42380.24e-66bZIP family protein